PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26527s0132.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 1172aa    MW: 129631 Da    PI: 7.0106
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26527s0132.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.6e-23127228199
                           EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                           f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F 
  Bostr.26527s0132.1.p 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI 214
                           99*****************************98888885.9************************************************ PP

                           E-SSSEE..EEEEE-S CS
                    B3  84 ldgrsefelvvkvfrk 99 
                           +  + +++l+++++r+
  Bostr.26527s0132.1.p 215 R--DGKAQLLLGIRRA 228
                           5..4678889999997 PP

2Auxin_resp117.51.1e-38253335183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  Bostr.26527s0132.1.p 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 335
                           799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-41121242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.07E-19126227No hitNo description
PROSITE profilePS5086312.125127229IPR003340B3 DNA binding domain
SMARTSM010199.7E-23127229IPR003340B3 DNA binding domain
PfamPF023623.1E-21127228IPR003340B3 DNA binding domain
PfamPF065071.0E-33253335IPR010525Auxin response factor
PfamPF023091.8E-910421130IPR033389AUX/IAA domain
PROSITE profilePS5174525.49210441137IPR000270PB1 domain
SuperFamilySSF542772.55E-810571122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1172 aa     Download sequence    Send to blast
MKAPSSNGVS PNPVEGERKN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLH NVTLNADPET DEVYAQMTLQ PVNKYDRDAL LASDMGLKIN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIYRGQPKRH LLTTGWSVFV STKRLFAGDS VLFIRDGKAQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGISD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFGGQPGM PDDETDMESA LKRAMPWLDM SSEMKDASST IFPGLSLVQW  420
MNMQQQNGQL PSAAAQPGFF PSMLSPTAAL HNNLGGTDDP SKILSFQTPQ GGISSSNLQF  480
NKPKPQAPMS QLPQPPTTLS QQQQLQQLLH SSFNHQQQQS QSQQQQQQQL LQQQQQLQSQ  540
QHCNNNQSQS QQQQQQQQQQ QQQQLLQQQQ QQQLLQQQHQ QPLQQQTQQQ PLRTQSLQSH  600
SHPQPQPQGP QQLQQHKLQQ LQLPQNQLYN GQQAAQQLQA QQHLQPQLVS GSVASGVITS  660
PSSSLNQSFQ QQQQSKQLQQ AHHHLGASTS QSSVIETSKP SSNLMSVSPQ ETQFPRQVEQ  720
QQPPGLKGQN QQTLLQQKVH QAQAQQIFQQ SLLEQPHLQF QLLQRLQQQQ QFLSPQSQLP  780
HHQLQSQQLQ QLPALSQGHQ FLSSCTNNGL STLQPPQMLV SRPQEKQNPP VGGGVKAYSG  840
ITDGGDAPSS STSPSTNNCQ ISSSGFLNRS QSGPAILIPD AATDMSGNLV QDLYNKSDMR  900
LKQELVSQQK SKASLTDHHL EASASGNSYG LDGGDNNRQQ NFLAPTFGLD GDSRNSLLGG  960
ANVDNGFVPD TLLSRGYDSQ KDLQNMLSNY GGVTNDIGTE MSTSAVRTQS FGVPNVPAIS  1020
NDLAVNDAGV LGGGLWPAQT QRMRTYTKVQ KRGSVGRSID VNRYRGYHEL RNDLARMFGI  1080
EGQLEDPQTS DWKLVYVDHE NDILLVGDDP WEEFVNCVQS IKILSSAEVQ QMSLDGNFAG  1140
VPITNQACSG GDSGNAWRGH YDDTSATSFN R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1691635645388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6697890.0AY669789.1 Arabidopsis thaliana clone C105344 ARF7 (At5g20730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLH9B4D10.0H9B4D1_BRARP; Auxin response factor
STRINGBra020125.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein